United Peptides Pharm

Loading

LL-37

Price range: $84.99 through $764.99

Quick Overview

High-purity LL-37 (human cathelicidin antimicrobial peptide) synthesized specifically for in vitro laboratory research and development. Formulated as a sterile, lyophilized powder to ensure maximum stability and precision in immunological, host defense, and cellular assays.

⚠️ STRICTLY FOR RESEARCH USE ONLY: This compound is not intended for human consumption, therapeutic, or diagnostic use.

Product Description

LL-37 is a crucial human cationic antimicrobial peptide belonging to the cathelicidin family, derived from the carboxy-terminal domain of the hCAP18 precursor protein. Naturally expressed by neutrophils, epithelial cells, and immune cells, it acts as a primary component of the innate immune system, demonstrating broad-spectrum activity against bacterial, fungal, and viral models. In vitro, LL-37 is heavily utilized for investigating immunomodulatory pathways, chemotaxis, wound re-epithelialization, and cellular membrane interactions.

Common Research Applications:

  • Antimicrobial Assays: Evaluating broad-spectrum activity against various bacterial, fungal, and viral cell lines in vitro.
  • Immunomodulation Studies: Investigating cytokine release, leukocyte chemotaxis, and inflammatory response modulation.
  • Wound Healing Models: Observing cellular re-epithelialization, angiogenesis, and keratinocyte migration kinetics.
  • Membrane Interaction Kinetics: Analyzing amphipathic peptide binding affinities and pore-forming mechanisms in synthetic lipid bilayers.

Technical Specifications

Compound Name LL-37 (Human Cathelicidin)
CAS Number 154947-66-7
Molecular Formula C205H340N60O53
Molecular Weight 4493.26 g/mol
Peptide Sequence [LL-37, 37 aa]
Purity (HPLC) ≥98.0%
Appearance White lyophilized solid
Solubility Soluble in ultrapure water or sterile buffer solutions

Storage and Reconstitution

To maintain peptide integrity and stability, please adhere to standard laboratory handling guidelines:

  • Lyophilized Form (Dry Powder): Store desiccated at -20°C (or below) upon receipt. While stable at room temperature for brief transit periods, long-term freezing is required to prevent degradation.
  • Reconstitution: Reconstitute using bacteriostatic water, sterile water, or appropriate assay buffer. Introduce the diluent carefully and gently swirl the vial until dissolved. Do not shake vigorously, as this can fracture the peptide bonds.
  • Liquid Storage (Reconstituted): Once reconstituted, store the solution at 2°C to 8°C (refrigerated) and utilize within standard laboratory storage windows (typically 14-30 days). For extended experimental timelines, aliquot the solution into individual vials and freeze at -20°C to avoid repeated freeze-thaw cycles.

Regulatory & Safety Disclaimer

NOTICE TO BUYER: By purchasing this product, you legally acknowledge and agree that it is strictly for Research Use Only (RUO). It is unequivocally prohibited to be used as a drug, food additive, cosmetic, or household chemical.

  • Not for Human or Animal Use: This material has not been evaluated or approved by the FDA (or any other international regulatory agency) for therapeutic, diagnostic, or clinical use.
  • Qualified Personnel: This product must be handled exclusively by qualified scientific professionals in a regulated laboratory setting, utilizing standard safety and sterile protocols.
  • Liability: The purchaser assumes all risks and liabilities associated with the handling, storage, and experimental application of this product.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.